HMG1 (HMGB1) (NM_002128) Human Recombinant Protein
Product Code
TP721133
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human high mobility group box 1 (HMGB1)
| SKU | TP721133 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | HMGB1 |
| aa sequence | GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKF* |
| Tag | His |
| Tag position | N-terminal |
| Accession No | NM_002128 |
| Gene id | 3146 |
| Gene synonyms | HMG-1, HMG1, HMG3, SBP-1 |
| Protein Families | Druggable Genome, Transcription Factors, Stem cell - Pluripotency |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |