Histone H2a, Full Length, Biotin-labeled, His-tag

Product Code
52049
$90.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

More Information
SKU 52049
Size 50 ug
Application Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Species Human
Expression Host E. coli
aa sequence 2-130(end) : MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGKC
Tag His
Tag position N-terminal
Label/Conjugate Biotin
Accession No NM_033445
Gene synonyms HIST1H2AI, H2A.1, histone H2A
Format Aqueous buffer solution
Storage >6 months at -80C.
Shipping Temp Dry Ice
Supplier Name BPS