Histone H1, Full Length, His-tag
Product Code
AMS.52043
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
| SKU | AMS.52043 |
|---|---|
| Size | 100 ug |
| Application | Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications. |
| Species | Human |
| Expression Host | E. coli |
| aa sequence | 2-194(end) : MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
| Tag | His |
| Accession No | NM_005318 |
| Gene synonyms | Histone H1, H1F0 |
| Storage | >= 6 months at -80C |
| Shipping Temp | Dry Ice |
| Supplier Name | BPS |