HEPC (HAMP) (NM_021175) Human Mass Spec Standard

Product Code
PH304620
$2,455.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

HAMP MS Standard C13 and N15-labeled recombinant protein (NP_066998)
More Information
SKU PH304620
Size 10 ug
Species Human
Expression Host HEK293
Gene symbol HAMP
aa sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDTHFPICIFCCGCCHRSKCG
Tag DDK, Myc
Tag position C-terminal
Accession No NM_021175
Gene id 57817
Gene synonyms HEPC, HFE2B, LEAP1, PLTR
Protein Families Transmembrane, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 3 weeks