GRO beta (CXCL2) (NM_002089) Human Recombinant Protein

Product Code
TP720606
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 2 (CXCL2)
More Information
SKU TP720606
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol CXCL2
aa sequence MTELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Tag Untagged
Accession No NM_002089
Gene id 2920
Gene synonyms CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days