GLP1 (GCG) (NM_002054) Human Recombinant Protein
Product Code
TP723140
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human glucagon (GCG).
| SKU | TP723140 |
|---|---|
| Size | 200 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | GCG |
| aa sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Tag | Untagged |
| Accession No | NM_002054 |
| Gene id | 2641 |
| Gene synonyms | GLP-1, GLP1, GLP2, GRPP |
| Protein Families | Druggable Genome, Secreted Protein, ES Cell Differentiation/IPS |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |