GAMT (NM_000156) Human Recombinant Protein
Product Code
TP721002
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human guanidinoacetate N-methyltransferase (GAMT), transcript variant 1
| SKU | TP721002 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | GAMT |
| aa sequence | MGSSHHHHHHSSGLVPRGSHMSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK |
| Tag | His |
| Tag position | C & N-terminal |
| Accession No | NM_000156 |
| Gene id | 2593 |
| Gene synonyms | CCDS2, HEL-S-20, PIG2, TP53I2 |
| Protein Families | Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |