FKBP2 (NM_057092) Human Mass Spec Standard
Product Code
PH301608
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_476433)
| SKU | PH301608 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | FKBP2 |
| aa sequence | ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTELVDHHHHHH |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_057092 |
| Gene id | 2286 |
| Gene synonyms | FKBP-13, FKBP13, PPIase |
| Protein Families | Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |