FGF19 (NM_005117) Human Recombinant Protein
Product Code
TP723094
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human fibroblast growth factor 19 (FGF19).
| SKU | TP723094 |
|---|---|
| Size | 25 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | FGF19 |
| aa sequence | MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Tag | Untagged |
| Accession No | NM_005117 |
| Gene id | 9965 |
| Gene synonyms | fibroblast growth factor 19 |
| Protein Families | Transmembrane, Druggable Genome, Secreted Protein, ES Cell Differentiation/IPS, Adult stem cells, Embryonic stem cells |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |