EGF, rat recombinant
Product Code
4024-100
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
| SKU | 4024-100 |
|---|---|
| Size | 100 ug |
| Species | Rat |
| Expression Host | E. coli |
| Gene symbol | EGF |
| aa sequence | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |
| Accession No | P07522 |
| Gene id | Rn. 6075 |
| Gene synonyms | Urogastrone, URG, EGF, epidermal growth factor |
| Storage | -20C |
| Shipping Temp | Gel Pack |
| Supplier Name | BioVision |