DNA polymerase delta p50 (POLD2) (NM_006230) Human Recombinant Protein
Product Code
TP720925
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human polymerase (DNA directed), delta 2, regulatory subunit 50kDa (POLD2), transcript variant 2
| SKU | TP720925 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | POLD2 |
| aa sequence | MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSR |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_006230 |
| Gene id | 5425 |
| Gene synonyms | delta 2, OTTHUMP00000024527, polymerase (DNA directed), delta 2, regulatory subunit, polymerase (DNA directed), delta 2, regulatory subunit (50kD), polymerase (DNA directed), delta 2, regulatory subunit 50kDa |
| Protein Families | Stem cell - Pluripotency |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |