Cxcl12 (NM_021704) Mouse Recombinant Protein

Product Code
TP723406
$290.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), transcript variant 1.
More Information
SKU TP723406
Size 10 ug
Species Mouse
Expression Host E. coli
Gene symbol Cxcl12
aa sequence KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM
Tag Untagged
Accession No NM_021704
Gene id 20315
Gene synonyms Pbsf, Scyb12, Sdf1, Tlsf, Tpar1
Storage -80C
Shipping Temp Dry Ice
Lead Time 2 Weeks