Cxcl12 (NM_001033882) Rat Recombinant Protein
Product Code
TP723407
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Rat chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (Cxcl12), transcript variant 2.
| SKU | TP723407 |
|---|---|
| Size | 10 ug |
| Species | Rat |
| Expression Host | E. coli |
| Gene symbol | Cxcl12 |
| aa sequence | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNKRLKM |
| Tag | Untagged |
| Accession No | NM_001033882 |
| Gene id | 24772 |
| Gene synonyms | Sdf1 |
| Storage | -80C |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |