Cxcl10 (NM_021274) Mouse Recombinant Protein
Product Code
TP723253
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10).
| SKU | TP723253 |
|---|---|
| Size | 25 ug |
| Species | Mouse |
| Expression Host | E. coli |
| Gene symbol | Cxcl10 |
| aa sequence | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP |
| Tag | Untagged |
| Accession No | NM_021274 |
| Gene id | 15945 |
| Gene synonyms | C7, CRG-2, gIP-10, Ifi10, INP10, IP-10, IP10, mob-1, Scyb10 |
| Storage | -80C |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |