CX3CL1 (NM_002996) Human Recombinant Protein
Product Code
TP723116
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human chemokine (C-X3-C motif) ligand 1 (CX3CL1).
| SKU | TP723116 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | CX3CL1 |
| aa sequence | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG |
| Tag | Untagged |
| Accession No | NM_002996 |
| Gene id | 6376 |
| Gene synonyms | ABCD-3, C3Xkine, CXC3, CXC3C, fractalkine, neurotactin, NTN, NTT, SCYD1 |
| Protein Families | Transmembrane, Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |