CTLA4 (NM_005214) Human Recombinant Protein
Product Code
TP721230
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human cytotoxic T-lymphocyte-associated protein 4 (CTLA4), transcript variant 1
| SKU | TP721230 |
|---|---|
| Size | 50 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | CTLA4 |
| aa sequence | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Tag | FC |
| Tag position | C-terminal |
| Accession No | NM_005214 |
| Gene id | 1493 |
| Gene synonyms | ALPS5, CD, CD152, CELIAC3, CTLA-4, GRD4, GSE, IDDM12 |
| Protein Families | Transmembrane, Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |