CNTF, rat recombinant
Product Code
4019-100
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
| SKU | 4019-100 |
|---|---|
| Size | 100 ug |
| Species | Rat |
| Expression Host | E. coli |
| Gene symbol | CNTF |
| aa sequence | AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
| Accession No | P26441 |
| Gene id | 1270 |
| Gene synonyms | HCNTF, CNTF, Ciliary Neurotrophic Factor. |
| Storage | -20C |
| Shipping Temp | Gel Pack |
| Supplier Name | BioVision |