CD252 (TNFSF4) (NM_003326) Human Recombinant Protein
Product Code
TP723346
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4).
| SKU | TP723346 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | Hi5 Cells, Insect Cells |
| Gene symbol | TNFSF4 |
| aa sequence | QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Tag | Untagged |
| Accession No | NM_003326 |
| Gene id | 7292 |
| Gene synonyms | CD134L, CD252, GP34, OX-40L, OX4OL, TXGP1 |
| Protein Families | Transmembrane, Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |