Ccl20 (NM_001159738) Mouse Recombinant Protein

Name: Ccl20 (NM_001159738) Mouse Recombinant Protein
Brand: TP723314
SKU: TP723314
Price: 290 USD
Availability: InStock

Product Code

TP723314

Skip to the end of the images gallery

Skip to the beginning of the images gallery

$290.00

Request Quote for Bulk Pricing

Shipping Information

Delivery charges will be calculated during checkout
View Ordering Terms

Product Updates

Keep up to date with product offers, resources and news
Sign up

Overview

Purified recombinant protein of Mouse chemokine (C-C motif) ligand 20 (Ccl20), transcript variant 2.

Product Specifications

More Information
SKU	TP723314
Size	20 ug
Species	Mouse
Expression Host	E. coli
Gene symbol	Ccl20
aa sequence	ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Tag	Untagged
Accession No	NM_001159738
Gene id	20297
Gene synonyms	CKb4, exodus-1, LARC, MIP-3A, MIP-3[a], MIP3A, Scya20, ST38
Storage	-80C
Shipping Temp	Dry Ice
Lead Time	5 Days

Datasheet/MSDS

Request Data Sheet

Request MSDS

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We are a global provider of human and animal biospecimens: including frozen & FFPE tissue, DNA, RNA, total proteins, blood products and primary cells.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

We provide the most advanced method for gene and shRNA delivery with an extensive collection of viral particles as well as a range of custom services.

Affordable & consistent controls from 50 tumor cell lines, ideal for IHC, in situ hybridization & NGS applications.

Affordable & consistent controls from 50 tumor cell lines, ideal for IHC, in situ hybridization & NGS applications.

Affordable & consistent controls from 50 tumor cell lines, ideal for IHC, in situ hybridization & NGS applications.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

ALiCE® is a radically different approach to cell-free expression and a kit unlike any others.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

The CELLBANKER® series of cryopreservation media allows for the stable long-term storage of any cell type, including sensitive cell lines.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

Prepared from Arthrobacter luteus, Zymolyase has a highly effective lytic activity against yeast cell walls.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

AMSBIO offers one of the largest selection of active recombinant enzymes and enzyme activity assays for profiling, inhibitor screening assays, and drug discovery.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

We supply a range of superior magnetic products each uniquely suited to specific protein purification, proteomics and genomics applications.

Ccl20 (NM_001159738) Mouse Recombinant Protein

Order Support

Order Support

Order Support

Order Support

Shipping Information

Product Updates

Call us at

Subscribe to our newsletter