CCL14 (NM_032963) Human Mass Spec Standard
Product Code
PH308370
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
CCL14 MS Standard C13 and N15-labeled recombinant protein (NP_116739)
| SKU | PH308370 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | CCL14 |
| aa sequence | GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_032963 |
| Gene id | 6358 |
| Gene synonyms | CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14 |
| Protein Families | Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |