BTN3A3 (NM_197974) Human Recombinant Protein
Product Code
TP721101
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human butyrophilin, subfamily 3, member A3 (BTN3A3), transcript variant 2
| SKU | TP721101 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | BTN3A3 |
| aa sequence | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_197974 |
| Gene id | 10384 |
| Gene synonyms | BTF3, BTN3.3 |
| Protein Families | Transmembrane, Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |