BRPF1, His-tag
Product Code
AMS.31112
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
| SKU | AMS.31112 |
|---|---|
| Size | 100 ug |
| Application | Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. |
| Species | Human |
| Expression Host | E. coli |
| aa sequence | 2054-2168: MHHHHHHMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVTELDEVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG |
| Tag | His |
| Accession No | NM_013450 |
| Gene synonyms | Human Bromodomain and PHD finger containing 1, BRPF1 |
| Storage | >6 months at -80C. |
| Shipping Temp | Dry Ice |
| Supplier Name | BPS |