BDNF (NM_170732) Human Recombinant Protein

Product Code
TP720589
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human brain-derived neurotrophic factor (BDNF), transcript variant 2
More Information
SKU TP720589
Size 10 ug
Species Human
Expression Host E. coli
Gene symbol BDNF
aa sequence MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Tag Untagged
Accession No NM_170732
Gene id 627
Gene synonyms ANON2, BULN2
Protein Families Transmembrane, Druggable Genome, Secreted Protein, ES Cell Differentiation/IPS, Adult stem cells, Embryonic stem cells, Induced pluripotent stem cells
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days