BCA1 (CXCL13) (NM_006419) Human Recombinant Protein
Product Code
TP723027
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 13 (CXCL13).
| SKU | TP723027 |
|---|---|
| Size | 20 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | CXCL13 |
| aa sequence | VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP |
| Tag | Untagged |
| Accession No | NM_006419 |
| Gene id | 10563 |
| Gene synonyms | ANGIE, ANGIE2, BCA-1, BCA1, BLC, BLR1L, SCYB13 |
| Protein Families | Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |