BAX (NM_138761) Human Mass Spec Standard
Product Code
PH304369
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
BAX MS Standard C13 and N15-labeled recombinant protein (NP_620116)
| SKU | PH304369 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | BAX |
| aa sequence | MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHHHHHH |
| Tag | DDK, Myc |
| Tag position | C-terminal |
| Accession No | NM_138761 |
| Gene id | 581 |
| Gene synonyms | BCL2L4 |
| Protein Families | Transmembrane, Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 3 weeks |