ATG4A (NM_178270) Human Recombinant Protein
Product Code
TP720907
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human ATG4 autophagy related 4 homolog A (S. cerevisiae) (ATG4A), transcript variant 2
| SKU | TP720907 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | ATG4A |
| aa sequence | MGSSHHHHHHSSGLVPRGSHMESVLSKYEDQITIFTDYLEEYPDTDELVWILGKQHLLKTEKSKLLSDISARLWFTYRRKFSPIGGTGPSSDAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRKDCCYSIHQMAQMGVGEGKSIGEWFGPNTVAQVLKKLALFDEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQ |
| Tag | His |
| Tag position | N-terminal |
| Accession No | NM_178270 |
| Gene id | 115201 |
| Gene synonyms | APG4A, AUTL2 |
| Protein Families | Protease |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |