Apolipoprotein A II (APOA2) (NM_001643) Human Recombinant Protein

Product Code
TP721104
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human apolipoprotein A-II (APOA2)
More Information
SKU TP721104
Size 10 ug
Species Human
Expression Host HEK293
Gene symbol APOA2
aa sequence QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQVDHHHHHH
Tag His
Tag position C-terminal
Accession No NM_001643
Gene id 336
Gene synonyms Apo-AII, ApoA-II, apoAII
Protein Families Druggable Genome, Secreted Protein
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days