Amphiregulin (AREG) (NM_001657) Human Recombinant Protein
Product Code
TP720947
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human amphiregulin (AREG)
| SKU | TP720947 |
|---|---|
| Size | 50 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | AREG |
| aa sequence | MSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSK |
| Tag | Untagged |
| Accession No | NM_001657 |
| Gene id | 374 |
| Gene synonyms | AR, AREGB, CRDGF, SDGF |
| Protein Families | Transmembrane, Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |