alpha Synuclein (SNCA) (NM_000345) Human Recombinant Protein

Product Code
TP721177
$360.00
Order Support
Shipping Information
Product Updates
  • Keep up to date with product offers, resources and news

  • Sign up

Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1
More Information
SKU TP721177
Size 50 ug
Species Human
Expression Host E. coli
Gene symbol SNCA
aa sequence MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAPGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA*
Tag His
Tag position N-terminal
Accession No NM_000345
Gene id 6622
Gene synonyms NACP, PARK1, PARK4, PD1
Protein Families Druggable Genome
Storage -80
Shipping Temp Dry Ice
Lead Time 5 Days