ALDH1A1 (NM_000689) Human Recombinant Protein
Product Code
TP720901
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human aldehyde dehydrogenase 1 family, member A1 (ALDH1A1)
| SKU | TP720901 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | E. coli |
| Gene symbol | ALDH1A1 |
| aa sequence | MGSSHHHHHHSSGLVPRGSHMSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISS |
| Tag | His |
| Tag position | N-terminal |
| Accession No | NM_000689 |
| Gene id | 216 |
| Gene synonyms | ALDC, ALDH-E1, ALDH1, ALDH11, HEL-9, HEL-S-53e, HEL12, PUMB1, RALDH1 |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |