Adipoq (NM_009605) Mouse Recombinant Protein
Product Code
TP723007
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq).
| SKU | TP723007 |
|---|---|
| Size | 25 ug |
| Species | Mouse |
| Expression Host | Hi5 Cells, Insect Cells |
| Gene symbol | Adipoq |
| aa sequence | RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
| Tag | His |
| Tag position | N-terminal |
| Accession No | NM_009605 |
| Gene id | 11450 |
| Gene synonyms | 30kDa, Acdc, Acrp30, Ad, adipo, apM1, APN, GBP28 |
| Storage | -80C |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |