Adiponectin (ADIPOQ) (NM_004797) Human Recombinant Protein
Product Code
TP723006
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human adiponectin, C1Q and collagen domain containing (ADIPOQ), transcript variant 2.
| SKU | TP723006 |
|---|---|
| Size | 25 ug |
| Species | Human |
| Expression Host | Hi5 Cells, Insect Cells |
| Gene symbol | ADIPOQ |
| aa sequence | RGHHHHHHHHETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
| Tag | His |
| Tag position | N-terminal |
| Accession No | NM_004797 |
| Gene id | 9370 |
| Gene synonyms | ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28 |
| Protein Families | Druggable Genome, Secreted Protein |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 5 Days |