CD3E (NM_000733) Human Recombinant Protein
Product Code
TP720690
Order Support
- Email: [email protected]
Order Support
- Email: [email protected]
Order Support
-
T: +1 (800) 987 0985 (toll free)
-
Email: [email protected]
Order Support
-
Email: [email protected]
Shipping Information
-
Delivery charges will be calculated during checkout
Product Updates
-
Keep up to date with product offers, resources and news
Purified recombinant protein of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E)
| SKU | TP720690 |
|---|---|
| Size | 10 ug |
| Species | Human |
| Expression Host | HEK293 |
| Gene symbol | CD3E |
| aa sequence | DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVDHHHHHH |
| Tag | His |
| Tag position | C-terminal |
| Accession No | NM_000733 |
| Gene id | 916 |
| Gene synonyms | IMD18, T3E, TCRE |
| Protein Families | Transmembrane, Druggable Genome |
| Storage | -80 |
| Shipping Temp | Dry Ice |
| Lead Time | 2 Weeks |